SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466148 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466148
Domain Number 1 Region: 32-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000672
Family UBX domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466148   Gene: ENSG00000167671   Transcript: ENST00000590466
Sequence length 131
Comment pep:putative chromosome:GRCh37:19:4445088:4446617:-1 gene:ENSG00000167671 transcript:ENST00000590466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APSWTGSAASSSPRPWPRSSNCLGTSSTSQQRRSSGSRGSGTFYARERLGAVYGFVREAL
QSDWLPFELLASGGQKLSEDENLALNECGLVPSALLTFSWDMAVLEDIKAAGAEPDSILK
PELLSAIEKLL
Download sequence
Identical sequences ENSP00000466148 ENSP00000466148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]