SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466224 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466224
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSP00000466224
Domain Number - Region: 131-179
Classification Level Classification E-value
Superfamily RNI-like 0.0746
Family Rna1p (RanGAP1), N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466224   Gene: ENSG00000196263   Transcript: ENST00000591537
Sequence length 247
Comment pep:putative chromosome:GRCh37:19:57019219:57041590:1 gene:ENSG00000196263 transcript:ENST00000591537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVEVVKVMPQDLVTFKDVAIDFSQEEWQWMNPAQKRLYRSMMLENYQSLVSLGLCISKP
YVISLLEQGREPWEMTSEMTRSPFSEFILVKNHMHVRNVEKPSSKGNTLLNITEHILERN
SLNVKNVGKPSNKVNTLFSIKEFILEKNHINVRNAEKPSDSLHTLLSIREFILERNPMNV
KNVAKPSVMARLLLDIRDVTLAKDPMNVLSVGRLLGITHLLFVTGGVIILERSLLIALIV
GKPSVFT
Download sequence
Identical sequences A0A2J8JLJ3
ENSP00000466224 ENSP00000466224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]