SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466226 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466226
Domain Number 1 Region: 3-43
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000511
Family UBA domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466226   Gene: ENSG00000179262   Transcript: ENST00000586375
Sequence length 62
Comment pep:known chromosome:GRCh37:19:13059503:13064219:1 gene:ENSG00000179262 transcript:ENST00000586375 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTQERTPWSSCGTSPSSRTC
GR
Download sequence
Identical sequences K7ELU6
ENSP00000466226 ENSP00000466226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]