SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466404 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466404
Domain Number 1 Region: 9-49
Classification Level Classification E-value
Superfamily UBA-like 0.000000179
Family TAP-C domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466404   Gene: ENSG00000153443   Transcript: ENST00000587615
Sequence length 152
Comment pep:putative chromosome:GRCh37:16:4659369:4664873:-1 gene:ENSG00000153443 transcript:ENST00000587615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYSHHHHQ
MASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQPPLWT
PTPPSPASDWPPLAPQQATSEPRAHPAMEAER
Download sequence
Identical sequences A0A2J8LAM1 K7EM88
ENSP00000466404 XP_016878426.1.92137 ENSP00000466404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]