SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466461 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466461
Domain Number 1 Region: 90-162
Classification Level Classification E-value
Superfamily TPR-like 2.71e-23
Family Tetratricopeptide repeat (TPR) 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466461   Gene: ENSG00000104969   Transcript: ENST00000589251
Sequence length 162
Comment pep:known chromosome:GRCh37:19:2763661:2783268:-1 gene:ENSG00000104969 transcript:ENST00000589251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPE
IFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIEL
NPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAY
Download sequence
Identical sequences K7EMD6
ENSP00000466461 ENSP00000466461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]