SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466537 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466537
Domain Number 1 Region: 9-193
Classification Level Classification E-value
Superfamily RNI-like 1.73e-16
Family 28-residue LRR 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466537   Gene: ENSG00000022556   Transcript: ENST00000540005
Sequence length 197
Comment pep:putative chromosome:GRCh37:19:55494854:55497769:1 gene:ENSG00000022556 transcript:ENST00000540005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSTVTDLQELLGCLYESQEEELVKEVMAQFKEISLHLNAVDVVPSSFCVKHCRNLQKMSL
QVIKENLPENVTASESDAEVERSQDDQHMLPFWTDLCSIFGSNKDLMGLAINDSFLSASL
VRILCEQIASDTCHLQRVVFKNISPADAHRNLCLALRGHKTVTYLTLQGNDQDDMFPALC
EVLRHPECNLRYLGYIS
Download sequence
Identical sequences K7EMK2
ENSP00000466537 ENSP00000483306 ENSP00000465083 ENSP00000465151 ENSP00000465331 ENSP00000465424 ENSP00000465735 ENSP00000466464 ENSP00000466537 ENSP00000466701 ENSP00000475138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]