SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466824 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466824
Domain Number 1 Region: 29-132
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.7e-24
Family Pyk2-associated protein beta ARF-GAP domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSP00000466824
Domain Number - Region: 73-85,132-172
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0252
Family Ankyrin repeat 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466824   Gene: ENSG00000108262   Transcript: ENST00000583413
Sequence length 173
Comment pep:putative chromosome:GRCh37:17:27909083:27921072:-1 gene:ENSG00000108262 transcript:ENST00000583413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHRHSPQPLPAALTAPAEEGHRGLYSHLDPGWASISRGVLVCDECCSVHRSLGRHISIV
KHLRHSAWPPTLLQMVHTLASNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIR
AKYQMLAFVHKLPCRDDDGVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANF
Download sequence
Identical sequences K7EN79
ENSP00000466824 ENSP00000466824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]