SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467467 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467467
Domain Number 1 Region: 15-84
Classification Level Classification E-value
Superfamily RNI-like 0.000000687
Family Cyclin A/CDK2-associated p19, Skp2 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467467   Gene: ENSG00000127452   Transcript: ENST00000590277
Sequence length 88
Comment pep:known chromosome:GRCh37:19:9922130:9929751:-1 gene:ENSG00000127452 transcript:ENST00000590277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPKVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVAD
LSMVPITSLPSTLRTLELHSCEISMAWL
Download sequence
Identical sequences A0A2J8LWR5 A0A2J8S1B3 K7EPN7
ENSP00000467467 ENSP00000467467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]