SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467508 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467508
Domain Number 1 Region: 49-117
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000576
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467508   Gene: ENSG00000071564   Transcript: ENST00000587425
Sequence length 163
Comment pep:known chromosome:GRCh37:19:1609471:1615797:-1 gene:ENSG00000071564 transcript:ENST00000587425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERR
VANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNL
NPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM
Download sequence
Identical sequences ENSP00000467508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]