SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467671 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000467671
Domain Number - Region: 9-42
Classification Level Classification E-value
Superfamily UBA-like 0.00158
Family TAP-C domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467671   Gene: ENSG00000153443   Transcript: ENST00000591401
Sequence length 156
Comment pep:novel chromosome:GRCh37:16:4658884:4664882:-1 gene:ENSG00000153443 transcript:ENST00000591401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFEMCTPANTPATPPNFPDALTM
FSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQP
PLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER
Download sequence
Identical sequences A0A2I3SH42 G3R5Q8 K7EQ49
ENSP00000467671 ENSP00000467671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]