SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468059 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468059
Domain Number 1 Region: 111-174
Classification Level Classification E-value
Superfamily RNI-like 0.0000000133
Family Cyclin A/CDK2-associated p19, Skp2 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468059   Gene: ENSG00000105341   Transcript: ENST00000590641
Sequence length 178
Comment pep:putative chromosome:GRCh37:19:41938751:41945481:-1 gene:ENSG00000105341 transcript:ENST00000590641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWDLVLEDRRMNSLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEA
LRDYLLQREMYKVHEKNRFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEGL
DNLLRLKELQSLSLQRCCHVDDWCLSRLYPLADSLQELSLAGCPRISERGLACLHHLQ
Download sequence
Identical sequences B4DFT4
NP_001307768.1.87134 NP_001307768.1.92137 ENSP00000468059 ENSP00000477461 ENSP00000468059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]