SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468104 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000468104
Domain Number - Region: 4-83
Classification Level Classification E-value
Superfamily Tropomyosin 0.0641
Family Tropomyosin 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468104   Gene: ENSG00000126581   Transcript: ENST00000589663
Sequence length 132
Comment pep:novel chromosome:GRCh37:17:40962688:40970596:-1 gene:ENSG00000126581 transcript:ENST00000589663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAEN
LEKVQAEAERLDQEEAQMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKW
GLAWVSSQFYNK
Download sequence
Identical sequences A0A1D5Q759 A0A2J8RET7 K7ER46
ENSP00000468104 ENSP00000468104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]