SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468204 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468204
Domain Number 1 Region: 571-962
Classification Level Classification E-value
Superfamily RNI-like 4.36e-61
Family 28-residue LRR 0.00025
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-22
Family Pyrin domain, PYD 0.0049
Further Details:      
 
Domain Number 3 Region: 171-258,287-344
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000906
Family Nucleotide and nucleoside kinases 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468204   Gene: ENSG00000263168   Transcript: ENST00000586781
Sequence length 980
Comment pep:known chromosome:GRCh37:HSCHR19LRC_LRC_J_CTG1:55459924:55478161:-1 gene:ENSG00000263168 transcript:ENST00000586781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPQLEWTLQTLLEQLNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVN
TSSENWIRNATVNILEEMNLTELCKMAKAEMMEDGQVQEIDNPELGDAEEDSELAKPGEK
EGWRNSMEKQSLVWKNTFWQGDIDNFHDDVTLRNQRFIPFLNPRTPRKLTPYTVVLHGPA
GVGKTTLAKKCMLDWTDCNLSPTLRYAFYLSCKELSRMGPCSFAELISKDWPELQDDIPS
ILAQAQRILFVVDGLDELKVPPGALIQDICGDWEKKKPVPVLLGSLLKRKMLPRAALLVT
TRPRALRDLQLLAQQPIYVRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLG
SAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAA
QGLWAQMSVFHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFY
ALEKEEGEDRDGHAWDIGDVQKLLSGEERLKNPDLIQVGHFLFGLANEKRAKELEATFGC
RMSPDIKQELLQCKAHLHANKPLSVTDLKEVLGCLYESQEEELAKVVVAPFKEISIHLTN
TSEVMHCSFSLKHCQDLQKLSLQVAKGVFLENYMDFELDIEFERCTYLTIPNWARQDLRS
LRLWTDFCSLFSSNSNLKFLEVKQSFLSDSSVRILCDHVTRSTCHLQKVEIKNVTPDTAY
RDFCLAFIGKKTLTHLTLAGHIEWERTMMLMLCDLLRNHKCNLQYLRLGGHCATPEQWAE
FFYVLKANQSLKHLRLSANVLLDEGAMLLYKTMTRPKHFLQMLSLENCRLTEASCKDLAA
VLVVSKKLTHLCLAKNPIGDTGVKFLCEGLSYPDCKLQTLVLQQCSITKLGCRYLSEALQ
EACSLTNLDLSINQIARGLWILCQALENPNCNLKHLRLKTYETNLEIKKLLEEVKEKNPK
LTIDCNASGATAPPCCDFFC
Download sequence
Identical sequences Q8WX94
NP_996611.2.87134 NP_996611.2.92137 ENSP00000339491 ENSP00000458215 ENSP00000458454 ENSP00000459548 ENSP00000459596 ENSP00000459959 ENSP00000460076 ENSP00000461532 ENSP00000464834 ENSP00000465333 ENSP00000465520 ENSP00000465583 ENSP00000466323 ENSP00000467002 ENSP00000467625 ENSP00000468204 ENSP00000474261 ENSP00000474886 gi|75709196|ref|NP_996611.2| ENSP00000339491 ENSP00000465520 ENSP00000478726 ENSP00000479541 ENSP00000480034 ENSP00000480449 ENSP00000481117 ENSP00000481809 ENSP00000483203 ENSP00000483353 ENSP00000484444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]