SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468257 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468257
Domain Number 1 Region: 17-82
Classification Level Classification E-value
Superfamily PH domain-like 0.0000317
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468257   Gene: ENSG00000104886   Transcript: ENST00000591099
Sequence length 94
Comment pep:putative chromosome:GRCh37:19:2233154:2236293:-1 gene:ENSG00000104886 transcript:ENST00000591099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEPVGALL
LERCRVVREEPGTFSITTSSCGEASSSTGTKSGR
Download sequence
Identical sequences K7ERH2
ENSP00000468257 ENSP00000468257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]