SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468481 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468481
Domain Number 1 Region: 90-158
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000955
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468481   Gene: ENSG00000071564   Transcript: ENST00000593064
Sequence length 204
Comment pep:known chromosome:GRCh37:19:1610966:1619208:-1 gene:ENSG00000071564 transcript:ENST00000593064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSA
ADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFK
ELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVV
GDPQMVLSAPHPGLSEAHNPAGHM
Download sequence
Identical sequences K7ERZ7
ENSP00000468481 ENSP00000468481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]