SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468577 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468577
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.59e-40
Family Calponin-homology domain, CH-domain 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468577   Gene: ENSG00000064666   Transcript: ENST00000569352
Sequence length 148
Comment pep:known chromosome:GRCh37:19:1026628:1037631:1 gene:ENSG00000064666 transcript:ENST00000569352 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTIL
CTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQV
QVSLLALAGKVRPREGQPPAQSHTARWM
Download sequence
Identical sequences A0A2I3RSI7 K7ES69
ENSP00000468577 ENSP00000468577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]