SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468674 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468674
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.6e-21
Family Ubiquitin-related 0.0000166
Further Details:      
 
Domain Number 2 Region: 228-272
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0000000000000569
Family XPC-binding domain 0.00016
Further Details:      
 
Domain Number 3 Region: 152-203
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000171
Family UBA domain 0.00024
Further Details:      
 
Domain Number 4 Region: 256-307
Classification Level Classification E-value
Superfamily UBA-like 0.000000000859
Family UBA domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468674   Gene: ENSG00000179262   Transcript: ENST00000592268
Sequence length 308
Comment pep:novel chromosome:GRCh37:19:13056706:13064405:1 gene:ENSG00000179262 transcript:ENST00000592268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVP
IRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAARE
DKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERV
VAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQ
FQNMRQVIQQNPALLPALLQQLGQENPQLLQLKALGFPESLVIQAYFACEKNENLAANFL
LSQNFDDE
Download sequence
Identical sequences A0A2I2YQN6 A0A2I3S4M9
NP_001257292.1.87134 NP_001257292.1.92137 ENSP00000468674 ENSP00000468674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]