SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468754 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468754
Domain Number 1 Region: 115-491
Classification Level Classification E-value
Superfamily RNI-like 3.35e-69
Family 28-residue LRR 0.0000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468754   Gene: ENSG00000160505   Transcript: ENST00000589437
Sequence length 504
Comment pep:novel chromosome:GRCh37:19:56370063:56393220:1 gene:ENSG00000160505 transcript:ENST00000589437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKILLKYGERESSYVFLHVCIQEFCAALFYLLKSHLDHPHPAVRCVQELLVANFEKARRA
HWIFLGCFLTGLLNKKEQEKLDAFFGFQLSQEIKQQIHQCLKSLGERGNPQGQVDSLAIF
YCLFEMQDPAFVKQAVNLLQEANFHIIDNVDLVVSAYCLKYCSSLRKLCFSVQNVFKKED
EHSSTSDYSLICWHHICSVLTTSGHLRELQVQDSTLSESTFVTWCNQLRHPSCRLQKLGI
NNVSFSGQSVLLFEVLFYQPDLKYLSFTLTKLSRDDIRSLCDALNYPAGNVKELALAFCH
LSEQCCEYISEMLLRNKSVRYLDLSANVLKDEGLKTLCEALKHPDCCLDSLCLVKCFITA
AGCEDLASALISNQNLKILQIGCNEIGDVGVQLLCRALTHTDCRLEILGLEECGLTSTCC
KDLASVLTCSKTLQQLNLTLNTLDHTGVVVLCEALRHPECALQVLGLRKTDFDEETQALL
TAEEERNPNLTITDDCDTITRVEI
Download sequence
Identical sequences K7ESK5
ENSP00000468754 ENSP00000468754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]