SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000469019 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000469019
Domain Number 1 Region: 157-214
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.01e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469019   Gene: ENSG00000232237   Transcript: ENST00000458416
Sequence length 278
Comment pep:known chromosome:GRCh37:1:201083880:201084796:-1 gene:ENSG00000232237 transcript:ENST00000458416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMGAAERGAGPQSSAAPWAGSEKAAKRGPSKSWYPRAAASDVTCPTGGDGADPKPGPFG
GGLALGPAPRGTMNNNFCRALVDRRPLGPPSCMQLGVMPPPRQAPLPPAEPLGNVPFLLY
PGPAEPPYYDAYAGVFPYVPFPGAFGVYEYPFEPAFIQKRNERERQRVKCVNEGYARLRG
HLPGALAEKRLSKVETLRAAIRYIKYLQELLSSAPDGSTPPASRGLPGTGPCPAPPATPR
PDRPGDGEARAPSSLVPESSESSCFSPSPFLESEESWH
Download sequence
Identical sequences Q7RTU5
ENSP00000469019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]