SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000469337 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000469337
Domain Number 1 Region: 314-502
Classification Level Classification E-value
Superfamily RNI-like 2.12e-25
Family 28-residue LRR 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469337   Gene: ENSG00000173988   Transcript: ENST00000595396
Sequence length 587
Comment pep:novel chromosome:GRCh37:13:46787170:46851501:1 gene:ENSG00000173988 transcript:ENST00000595396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKPPLLLRRPLPPKFTKLSLHEKKTHTAKTGKIESLHVAFTEDETTSIKMDRTRFPDVL
RNQSLTPINIQNIFLDHCVQERVTAISSPQKSTKHVREQIPDTATGSIFFPHCNSASTRI
FGKQTNKMESSRKFKTMKDVYTEKRLENILILSSKFSKPKSTPGSVIAQKLEKMHPKHQP
LPESPGYTYQHISRDLSATVPSPPPMTVSMKPEGQWPEHFKSTATLTLRVTEFPGFVSLP
TPVLPRKPHRQSVIETLVTENGNIESVPKQIPPRPPEGLTKTEKIESEIHVVRGEGFKTV
AATRYETITAMTNLAIVNCQVYGRNALNLKGFFILNCPDLTPLAFQLIYLNLSFNDLHYF
PTEILCLKNLQILKLRNNPIKEIPSEIQQLEFLRIFTIAFNLITVLPIGLFSLSYLEELD
VSYNELTFIPNEIQKLRSLEKLTVDGNELSFFPHGILKLNLTKIQFENNFTHPCFWRDNY
LNNPQQLTQIISLFIVQNKLHKFYDKIPVEVQKLLKCTSRCEWCHGPKFGEGFRVIRSCD
IFGASQLPVMFYVCSPSCYRRIKESSFVLDGSPSRRIALDVELSKEL
Download sequence
Identical sequences J3KQU2
NP_001269389.1.87134 NP_001269389.1.92137 XP_016875910.1.92137 ENSP00000469337 ENSP00000408828 ENSP00000469337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]