SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000469342 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000469342
Domain Number 1 Region: 137-262
Classification Level Classification E-value
Superfamily TPR-like 0.000000000192
Family Tetratricopeptide repeat (TPR) 0.072
Further Details:      
 
Domain Number 2 Region: 48-169
Classification Level Classification E-value
Superfamily TPR-like 0.000000103
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSP00000469342
Domain Number - Region: 272-381
Classification Level Classification E-value
Superfamily TPR-like 0.000104
Family Tetratricopeptide repeat (TPR) 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469342   Gene: ENSG00000269714   Transcript: ENST00000599189
Sequence length 393
Comment pep:known chromosome:GRCh37:HG971_PATCH:99679552:99792747:-1 gene:ENSG00000269714 transcript:ENST00000599189 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MQESQETHISNHLDEVVAAVSITHRKKFQNKLLQTALFQPPREKLHLCEEKAKSYSNSHE
YKQAVHELVRCVALTRICYGDSHWKLAEAHVNLAQGYLQLKGLSLQAKQHAEKARQILAN
SIVPPYSENTDVFKFSIELFHTMGRALLSLQKFKEAAENLTKAERLSKELLQCGRIIKEE
WIEIEARIRLSFAQVYQGQKKSKEALSHYQAALEYVEISKGETSRECVPILRELAGVEQA
LGLHDVSINHFLQAHLIILSRSPSQVEAADSAHIVAHAAVASGRHEHHDVAEQYFQESMA
HLKDSEGMGRTKFLSIQDEFCHFLQMTGQKERATSILRESLEAKVEAFGDFSPEVAETYR
LLGGADLAQGNHSGARKKLKKGDLSFLLSATLP
Download sequence
Identical sequences A0A024RC85
ENSP00000262074 ENSP00000433162 GO.36805 HR5838 ENSP00000377688 ENSP00000433162 ENSP00000469342 ENSP00000470802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]