SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000469364 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000469364
Domain Number 1 Region: 83-124,179-209
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.2e-16
Family HLH, helix-loop-helix DNA-binding domain 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSP00000469364
Domain Number - Region: 200-240
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0169
Family Leucine zipper domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469364   Gene: ENSG00000105698   Transcript: ENST00000599471
Sequence length 253
Comment pep:putative chromosome:GRCh37:19:35761353:35770570:1 gene:ENSG00000105698 transcript:ENST00000599471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMMTPQD
VLQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPD
CNADNSKTGAVSTPDPQCLRWSRPPTLACRKSNSHGARESSLGWRPVGGACPKAPGPLAP
QSKGGILSKACDYIRELRQTNQRMQETFKEAERLQMDNELLRQQIEELKNENALLRAQLQ
QHNLEMVGEGTRQ
Download sequence
Identical sequences M0QXT0
ENSP00000469364 ENSP00000469364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]