SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000470081 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470081
Domain Number 1 Region: 32-107
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.62e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000637
Further Details:      
 
Weak hits

Sequence:  ENSP00000470081
Domain Number - Region: 98-139
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00478
Family Leucine zipper domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470081   Gene: ENSG00000105698   Transcript: ENST00000599625
Sequence length 149
Comment pep:putative chromosome:GRCh37:19:35761904:35770150:1 gene:ENSG00000105698 transcript:ENST00000599625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSNLILSRCLGKQLCDNTCPLFFSSSCRKIDGTRTPRDERRRAQHNEVERRRRDKINNWI
VQLSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQETFKEAERLQMDNELLR
QQIEELKNENALLRAQLQQHNLEMVGEGT
Download sequence
Identical sequences M0QYU7
ENSP00000470081 ENSP00000470081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]