SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000471018 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471018
Domain Number 1 Region: 2-137
Classification Level Classification E-value
Superfamily TPR-like 5.44e-37
Family Tetratricopeptide repeat (TPR) 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471018   Gene: ENSG00000105402   Transcript: ENST00000597118
Sequence length 137
Comment pep:putative chromosome:GRCh37:19:47996218:48016059:-1 gene:ENSG00000105402 transcript:ENST00000597118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKMAKNWSAAGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEI
YTDMGRFTIAAKHHISIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAG
YAALLEQYQKAIDIYEQ
Download sequence
Identical sequences A0A2J8K1S2 A0A2J8U791 M0R058
ENSP00000471018 ENSP00000471018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]