SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000471239 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471239
Domain Number 1 Region: 117-152
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000235
Family CCCH zinc finger 0.00023
Further Details:      
 
Domain Number 2 Region: 155-186
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000131
Family CCCH zinc finger 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471239   Gene: ENSG00000128016   Transcript: ENST00000594442
Sequence length 343
Comment pep:putative chromosome:GRCh37:19:39897498:39900008:1 gene:ENSG00000128016 transcript:ENST00000594442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XALPLSADTPHGQPLHHGSDCHLRGDLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPS
DSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSR
YKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCH
FIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPG
DLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDE
YASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE
Download sequence
Identical sequences M0R0H3
ENSP00000471239 ENSP00000471239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]