SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000471273 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471273
Domain Number 1 Region: 599-1046
Classification Level Classification E-value
Superfamily RNI-like 1.47e-72
Family 28-residue LRR 0.0000327
Further Details:      
 
Domain Number 2 Region: 32-120
Classification Level Classification E-value
Superfamily DEATH domain 1.88e-22
Family Pyrin domain, PYD 0.0049
Further Details:      
 
Domain Number 3 Region: 199-286,315-372
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000103
Family Nucleotide and nucleoside kinases 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471273   Gene: ENSG00000269459   Transcript: ENST00000600360
Sequence length 1065
Comment pep:known chromosome:GRCh37:HSCHR19LRC_PGF1_CTG1:55356752:55397872:-1 gene:ENSG00000269459 transcript:ENST00000600360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKHRLEARPDLREFFSLNLRSHTRSTMTSPQLEWTLQTLLEQLNEDELKSFKSLLWAF
PLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLTELCKMAKAEMM
EDGQVQEIDNPELGDAEEDSELAKPGEKEGWRNSMEKQSLVWKNTFWQGDIDNFHDDVTL
RNQRFIPFLNPRTPRKLTPYTVVLHGPAGVGKTTLAKKCMLDWTDCNLSPTLRYAFYLSC
KELSRMGPCSFAELISKDWPELQDDIPSILAQAQRILFVVDGLDELKVPPGALIQDICGD
WEKKKPVPVLLGSLLKRKMLPRAALLVTTRPRALRDLQLLAQQPIYVRVEGFLEEDRRAY
FLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTG
LFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQMSVFHREDLERLGVQESDLRLFLDGD
ILRQDRVSKGCYSFIHLSFQQFLTALFYTLEKEEGEDRDGHAWDIGDVQKLLSGEERLKN
PDLIQVGHFLFGLANEKRAKELEATFGCRMSPDIKQELLQCKAHLHANKPLSVTDLKEVL
GCLYESQEEELAKVVVAPFKEISIHLTNTSEVMHCSFSLKHCQDLQKLSLQVAKGVFLEN
YMDFELDIEFERCTYLTIPNWARQDLRSLRLWTDFCSLFSSNSNLKFLEVKQSFLSDSSV
RILCDHVTRSTCHLQKVEIKNVTPDTAYRDFCLAFIGKKTLTHLTLAGHIEWERTMMLML
CDLLRNHKCNLQYLRLGGHCATPEQWAEFFYVLKANQSLKHLRLSANVLLDEGAMLLYKT
MTRPKHFLQMLSLENCRLTEASCKDLAAVLVVSKKLTHLCLAKNPIGDTGVKFLCEGLSY
PDCKLQTLVLQQCSITKLGCRYLSEALQEACSLTNLDLSINQIARGLWILCQALENPNCN
LKHLRLWSCSLMPFYCQHLGSALLSNQKLETLDLGQNHLWKSGIIKLFGVLRQRTGSLKI
LRLKTYETNLEIKKLLEEVKEKNPKLTIDCNASGATAPPCCDFFC
Download sequence
Identical sequences ENSP00000471273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]