SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000471775 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471775
Domain Number 1 Region: 105-143
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000785
Family HLH, helix-loop-helix DNA-binding domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471775   Gene: ENSG00000105698   Transcript: ENST00000596380
Sequence length 143
Comment pep:putative chromosome:GRCh37:19:35761166:35769668:1 gene:ENSG00000105698 transcript:ENST00000596380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGRDGGTEKAKGSLCPPTPQAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVS
VQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQHNE
VERRRRDKINNWIVQLSKIIPDC
Download sequence
Identical sequences A0A2J8QH82 M0R1C6
ENSP00000471775 ENSP00000471775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]