SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000472422 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000472422
Domain Number 1 Region: 14-127
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.4e-20
Family Protein kinases, catalytic subunit 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000472422   Gene: ENSG00000268444   Transcript: ENST00000594739
Sequence length 129
Comment pep:putative chromosome:GRCh37:HG1497_PATCH:152953176:152953876:1 gene:ENSG00000268444 transcript:ENST00000594739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTALAPARPQGSPCFQHKHFTEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGD
YLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALSGRYSREFFNRRGELRHIHNLKHWGL
YEVLMEKYE
Download sequence
Identical sequences H7C2I2
ENSP00000406166 ENSP00000406166 ENSP00000472422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]