SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000473016 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000473016
Domain Number 1 Region: 3-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.28e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000473016   Gene: ENSG00000197841   Transcript: ENST00000595708
Sequence length 144
Comment pep:known chromosome:GRCh37:19:35225151:35231723:1 gene:ENSG00000197841 transcript:ENST00000595708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQVTFNDVAIDFTHEEWGWLSSAQRDLYKDVMVQNYENLVSVGLSVTKPYVITLLEDGK
EPWMMEKKLSKGMIPDWESRWENKELSTKKDNYDEDSPQTVIIEKVVKQSYEFSNSKKNL
EYIEKLEGKHGSQVDHFRPAILTS
Download sequence
Identical sequences M0R361
ENSP00000473016 ENSP00000473016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]