SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000473277 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000473277
Domain Number 1 Region: 31-96
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000205
Family Phosphotyrosine-binding domain (PTB) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000473277   Gene: ENSG00000185046   Transcript: ENST00000547362
Sequence length 107
Comment pep:known chromosome:GRCh37:12:99139238:99225919:-1 gene:ENSG00000185046 transcript:ENST00000547362 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MQGDARRRRNENYFDDIPRSKLERQMAQTGDWGEPSITLRPPNEATASTPVQYWQHHPEK
LIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRLSNFNFRSLQSK
Download sequence
Identical sequences A0A2J8N0H2 A0A2J8XMP0 R4GMN5
ENSP00000473277 ENSP00000473277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]