SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000473581 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000473581
Domain Number - Region: 12-76
Classification Level Classification E-value
Superfamily EF-hand 0.000619
Family Calmodulin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000473581   Gene: ENSG00000109689   Transcript: ENST00000478049
Sequence length 87
Comment pep:putative chromosome:GRCh37:4:26863081:26997024:1 gene:ENSG00000109689 transcript:ENST00000478049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSPPCFTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLH
REDKHITIEDLWKRWKTSEVHNWTLED
Download sequence
Identical sequences A0A2J8R2Q0 R4GNC5
ENSP00000473581 ENSP00000473581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]