SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000473616 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000473616
Domain Number 1 Region: 1-46
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000289
Family TAP-C domain-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000473616   Gene: ENSG00000088833   Transcript: ENST00000489203
Sequence length 105
Comment pep:known chromosome:GRCh37:20:1434858:1447469:-1 gene:ENSG00000088833 transcript:ENST00000489203 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
VSRGTAPSDNRVTSFRDLIHDQDEDEEEEEGQRGHSVCHMNGKVR
Download sequence
Identical sequences A0A2I2Z0N0 A0A2I3SLA3 A0A2J8VI69 A0A2K6QNZ6 R4GNE6
ENSP00000473616 ENSP00000473616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]