SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000474302 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000474302
Domain Number 1 Region: 152-199
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.42e-16
Family LIM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 31-79
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000105
Family LIM domain 0.00078
Further Details:      
 
Domain Number 3 Region: 112-151
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000984
Family LIM domain 0.0069
Further Details:      
 
Domain Number 4 Region: 3-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000202
Family LIM domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000474302   Gene: ENSG00000270931   Transcript: ENST00000603102
Sequence length 208
Comment pep:known chromosome:GRCh37:HG1592_PATCH:105940487:105946499:1 gene:ENSG00000270931 transcript:ENST00000603102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYAT
LFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFT
GEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYG
ILFGPKGVNTGAVGSYIYDRDPEGKVQP
Download sequence
Identical sequences A0A2J8SYZ7 A0A2K5N9Y4 A0A2K6MXY8 A0A2K6QW04 H9FQ52 K7C6K7 P52943
9606.ENSP00000328521 ENSP00000328521 NP_001303.1.87134 NP_001303.1.92137 XP_010375209.1.97406 XP_011939612.1.92194 XP_015000112.1.72884 XP_016782356.1.37143 XP_017708310.1.44346 ENSP00000328521 ENSP00000474302 gi|4503049|ref|NP_001303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]