SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000475542 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000475542
Domain Number 1 Region: 14-134
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000475542   Gene: ENSG00000273121   Transcript: ENST00000606597
Sequence length 259
Comment pep:known chromosome:GRCh37:HSCHR22_1_CTG1:42470255:42475445:1 gene:ENSG00000273121 transcript:ENST00000606597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLNERSVAHYALSDSPADHMGFLRTWGGPGTPPTPSGTGRRCWFVLKGNLLFSFESREG
RAPLSLVVLEGCTVELAEAPVPEEFAFAICFDAPGVRPHLLAAEGPAAQEAWVKVLSRAS
FGYMRLVVRELESQLQDARQSLALQRRSSWKSVASRCKPQAPNHRAAGLENGHCLSKDSS
PVGLVEEAGSRSAGWGLAEWELQGPASLLLGKGQSPVSPETSCFSTLHDWYGQEIVELRQ
CWQKRAQGSHSKCEEQDRP
Download sequence
Identical sequences Q6ICB4
ENSP00000312753 ENSP00000312753 gi|115583657|ref|NP_001002034.2| ENSP00000312753 ENSP00000475303 ENSP00000475542 NP_001002034.2.87134 NP_001002034.2.92137 XP_005261430.1.92137 GO.99746 9606.ENSP00000312753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]