SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000476663 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000476663
Domain Number 1 Region: 113-174
Classification Level Classification E-value
Superfamily RNI-like 0.000000051
Family Cyclin A/CDK2-associated p19, Skp2 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000476663   Gene: ENSG00000272997   Transcript: ENST00000609546
Sequence length 176
Comment pep:novel chromosome:GRCh37:HG1350_HG959_PATCH:41939189:41945815:-1 gene:ENSG00000272997 transcript:ENST00000609546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLL
QREMYKILHLAGEATWSIRRRFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINY
EGLDNLLRLKELQSLSLQRCCHVDDWCLSRLYPLADSLQELSLAGCPRISERGLAC
Download sequence
Identical sequences K7EIV4
ENSP00000464907 ENSP00000476663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]