SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000476726 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000476726
Domain Number - Region: 79-98
Classification Level Classification E-value
Superfamily SOCS box-like 0.0837
Family SOCS box-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000476726   Gene: ENSG00000203880   Transcript: ENST00000609818
Sequence length 183
Comment pep:putative chromosome:GRCh37:20:62896865:62904898:1 gene:ENSG00000203880 transcript:ENST00000609818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNFLHFTNEETEAGTGEGDAGSRTCPSWGQKLTQLTKITRTGPSAWETKKILAVSFAPLI
QPCHSESGKSRLVQLPPVAVRSLQDLARIAIRGTIKKIIHQETVSKNGNGLKNTPRFKRR
RVRRRRMETIVFLDKEVFASRISNPSDDNSCEDLEEERREEEEKTPPETKPDPPVNFLRQ
KVL
Download sequence
Identical sequences A0A2J8KNF0 V9GYG6
ENSP00000476726 ENSP00000476726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]