SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000477129 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000477129
Domain Number 1 Region: 107-187
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000124
Family Cyclin A/CDK2-associated p19, Skp2 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000477129   Gene: ENSG00000272997   Transcript: ENST00000608638
Sequence length 230
Comment pep:known chromosome:GRCh37:HG1350_HG959_PATCH:41937244:41945841:-1 gene:ENSG00000272997 transcript:ENST00000608638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLL
QREMYKVHEKNRFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEGLDNLLRL
KELQSLSLQRCCHVDDWCLSRLYPLADSLQELSLAGCPRISERGLACLHHLQNLRRLDIS
DLPAVSNPGLTQILVEEMLPNCEVVGVDWAEGLKSGPEEQPRDTASPVPA
Download sequence
Identical sequences gi|268832194|ref|NP_001161343.1| NP_001161343.1.87134 NP_001161343.1.92137 ENSP00000467205 ENSP00000467205 ENSP00000477129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]