SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000477446 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000477446
Domain Number 1 Region: 105-194
Classification Level Classification E-value
Superfamily Integrin domains 1.41e-30
Family Integrin domains 0.0001
Further Details:      
 
Domain Number 2 Region: 1-105
Classification Level Classification E-value
Superfamily vWA-like 7.11e-25
Family Integrin A (or I) domain 0.0000187
Further Details:      
 
Domain Number 3 Region: 277-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSP00000477446
Domain Number - Region: 246-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number - Region: 202-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0246
Family Integrin beta EGF-like domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000477446   Gene: ENSG00000082781   Transcript: ENST00000488466
Sequence length 323
Comment pep:putative chromosome:GRCh37:3:124492666:124567298:-1 gene:ENSG00000082781 transcript:ENST00000488466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFG
FRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKSIRSKVELSVWDQPED
LNLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFALRPVGFRDS
LEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNL
CREAEGKPLCSGRGDCSCNQCSCFESEFGKIYGPFCECDNFSCARNKGVLCSGHGECHCG
ECKCHAGYIGDNCNCSTDISTCR
Download sequence
Identical sequences V9GZ57
ENSP00000477446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]