SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000477500 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000477500
Domain Number 1 Region: 105-168
Classification Level Classification E-value
Superfamily RNI-like 0.0000000128
Family Cyclin A/CDK2-associated p19, Skp2 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000477500   Gene: ENSG00000272997   Transcript: ENST00000607973
Sequence length 172
Comment pep:putative chromosome:GRCh37:HG1350_HG959_PATCH:41939129:41945813:-1 gene:ENSG00000272997 transcript:ENST00000607973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLL
QREMYKVHEKNRFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEGLDNLLRL
KELQSLSLQRCCHVDDWCLSRLYPLADSLQELSLAGCPRISERGLACLHHLQ
Download sequence
Identical sequences M0QZC4
NP_001307773.1.87134 NP_001307773.1.92137 ENSP00000470444 ENSP00000477500 ENSP00000470444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]