SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000158762 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000158762
Domain Number 1 Region: 4-288
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.24e-65
Family BAR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 407-522
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.79e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00019
Further Details:      
 
Domain Number 3 Region: 261-362
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-26
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Domain Number 4 Region: 590-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.24e-23
Family Ankyrin repeat 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000158762   Gene: ENSG00000072818   Transcript: ENST00000158762
Sequence length 740
Comment pep:known chromosome:GRCh37:17:7239848:7254797:1 gene:ENSG00000072818 transcript:ENST00000158762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRHYLAASRAFV
VGICDLARLGPPEPMMAECLEKFTVSLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRGF
REARRDFWRGAESLEAALTHNAEVPRRRAQEAEEAGAALRTARAGYRGRALDYALQINVI
EDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQ
RHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKK
YKDPVTVVVDDLRLCTVKLCPDSERRFCFEVVSTSKSCLLQADSERLLQLWVSAVQSSIA
SAFSQARLDDSPRGPGQGSGHLAIGSAATLGSGGMARGREPGGVGHVVAQVQSVDGNAQC
CDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVI
INQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGRPRGQP
PVPPKPSIRPRPGSLRSKPEPPSEDLGSLHPGALLFRASGHPPSLPTMADALAHGADVNW
VNGGQDNATPLIQATAANSLLACEFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFL
KRGADLGARDSEGRDPLTIAMETANADIVTLLRLAKMREAEAAQGQAGDETYLDIFRDFS
LMASDDPEKLSRRSHDLHTL
Download sequence
Identical sequences Q15027
ENSP00000158762 ENSP00000158762 NP_055531.1.87134 NP_055531.1.92137 gi|7661880|ref|NP_055531.1| ENSP00000158762 9606.ENSP00000158762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]