SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000209929 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000209929
Domain Number 1 Region: 3-241
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.22e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0024
Further Details:      
 
Domain Number 2 Region: 311-455
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000751
Family FAD/NAD-linked reductases, N-terminal and central domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000209929   Gene: ENSG00000094963   Transcript: ENST00000209929
Sequence length 471
Comment pep:known chromosome:GRCh37:1:171154347:171180369:1 gene:ENSG00000094963 transcript:ENST00000209929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGVWRFKENVEDGRASIYQSVVT
NTSKEMSCFSDFPMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRKCPDFS
SSGQWKVVTQSNGKEQSAVFDAVMVCSGHHILPHIPLKSFPGMERFKGQYFHSRQYKHPD
GFEGKRILVIGMGNSGSDIAVELSKNAAQVFISTRHGTWVMSRISEDGYPWDSVFHTRFR
SMLRNVLPRTAVKWMIEQQMNRWFNHENYGLEPQNKYIMKEPVLNDDVPSRLLCGAIKVK
STVKELTETSAIFEDGTVEENIDVIIFATGYSFSFPFLEDSLVKVENNMVSLYKYIFPAH
LDKSTLACIGLIQPLGSIFPTAELQARWVTRVFKGLCSLPSERTMMMDIIKRNEKRIDLF
GESQSQTLQTNYVDYLDELALEIGAKPDFCSLLFKDPKLAVRLYFGPCNSY
Download sequence
Identical sequences Q99518
9606.ENSP00000209929 ENSP00000209929 ENSP00000209929 ENSP00000405905 gi|4503757|ref|NP_001451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]