SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000210060 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000210060
Domain Number 1 Region: 13-363
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.55e-144
Family Deoxyhypusine synthase, DHS 0.00000000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000210060   Gene: ENSG00000095059   Transcript: ENST00000210060
Sequence length 369
Comment pep:known chromosome:GRCh37:19:12786535:12792716:-1 gene:ENSG00000095059 transcript:ENST00000210060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFG
RAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLV
QHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFE
DWLMPILDQMVMEQNTEGVKWTPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGS
LGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMIILGGGVVKHHIANANLMRNGA
DYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLLVAETFAQKMD
AFMHEKNED
Download sequence
Identical sequences A0A024R7D0 P49366
gi|4503325|ref|NP_001921.1| ENSP00000210060 cath|current|1rlzA00/9-369 NP_001921.1.87134 NP_001921.1.92137 XP_011526072.1.92137 ENSP00000210060 9606.ENSP00000210060 1rlz_A 1roz_A 1roz_B 1rqd_A 1rqd_B ENSP00000210060 1rozA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]