SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000218176 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000218176
Domain Number 1 Region: 182-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.78e-58
Family Voltage-gated potassium channels 0.00077
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.66e-32
Family Tetramerization domain of potassium channels 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000218176   Gene: ENSG00000102057   Transcript: ENST00000218176
Sequence length 647
Comment pep:known chromosome:GRCh37:X:48818647:48827976:-1 gene:ENSG00000102057 transcript:ENST00000218176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGLATWLPFARAAAVGWLPLAQQPLPPAPGVKASRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGDGPALPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGSARRSSREQPCGERFPQAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLLVPKNDDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTNKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRR
AIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIIS
IPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL
Download sequence
Identical sequences H2QYK7 Q9NSA2
ENSP00000218176 NP_004970.3.87134 NP_004970.3.92137 XP_011542212.1.92137 XP_014198917.1.60992 XP_016798893.1.37143 XP_016798894.1.37143 ENSP00000218176 ENSP00000471039 ENSP00000365660 gi|27436981|ref|NP_004970.3| 9606.ENSP00000218176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]