SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000223366 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000223366
Domain Number 1 Region: 220-460
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.66e-82
Family Hexokinase 0.00000000058
Further Details:      
 
Domain Number 2 Region: 9-218
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.3e-76
Family Hexokinase 0.00000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000223366   Gene: ENSG00000106633   Transcript: ENST00000345378
Sequence length 466
Comment pep:known chromosome:GRCh37:7:44183877:44198881:-1 gene:ENSG00000106633 transcript:ENST00000345378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMDVTRSQAQTALTLVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLP
TYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTA
EMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGN
NVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQ
NVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMG
ELVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGLRP
STTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSF
KERFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ
Download sequence
Identical sequences A0A2J8L9I2
gi|15967159|ref|NP_277042.1| ENSP00000384247 ENSP00000223366 ENSP00000223366 9606.ENSP00000223366 NP_277042.1.87134 NP_277042.1.92137 XP_003805279.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]