SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000225441 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000225441
Domain Number 1 Region: 26-193
Classification Level Classification E-value
Superfamily RUN domain-like 3.66e-43
Family RUN domain 0.0000553
Further Details:      
 
Weak hits

Sequence:  ENSP00000225441
Domain Number - Region: 250-318
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0562
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000225441   Gene: ENSG00000108309   Transcript: ENST00000225441
Sequence length 405
Comment pep:known chromosome:GRCh37:17:42385964:42395238:1 gene:ENSG00000108309 transcript:ENST00000225441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASFVQTTMALGLSSKKASSRNVAVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFVN
FAAILEQILSHRFKACAPAGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENIST
ARAKGRAWIRVALMEKRMSEYITTALRDTRTTRRFYDSGAIMLRDEATILTGMLIGLSAI
DFSFCLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPL
VTDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQN
QREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSK
LYRRHSFMSTEPLSAEASLSSDSQRLGEGTRDEEPWGPIGSSEPN
Download sequence
Identical sequences A0A2J8J4I0 A0A2K5NT80 A0A2K5Z192 A0A2K6B3M8
NP_006686.1.87134 NP_006686.1.92137 XP_008010619.1.81039 XP_011717963.1.29376 XP_011841300.1.47321 XP_011914122.1.92194 XP_014975348.1.72884 XP_016787149.1.37143 gi|5730015|ref|NP_006686.1| GO.36609 O60651 ENSP00000225441 ENSP00000225441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]