SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000227758 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000227758
Domain Number 1 Region: 263-350,556-593
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.83e-44
Family Inhibitor of apoptosis (IAP) repeat 0.00000198
Further Details:      
 
Domain Number 2 Region: 176-251
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.3e-31
Family Inhibitor of apoptosis (IAP) repeat 0.0000787
Further Details:      
 
Domain Number 3 Region: 39-137
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 3.01e-30
Family Inhibitor of apoptosis (IAP) repeat 0.00033
Further Details:      
 
Domain Number 4 Region: 453-551
Classification Level Classification E-value
Superfamily DEATH domain 6.59e-23
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000227758   Gene: ENSG00000110330   Transcript: ENST00000227758
Sequence length 618
Comment pep:known chromosome:GRCh37:11:102217966:102249401:1 gene:ENSG00000110330 transcript:ENST00000227758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS
Download sequence
Identical sequences Q13490
9606.ENSP00000227758 gi|4502141|ref|NP_001157.1| ENSP00000227758 ENSP00000477613 NP_001157.1.87134 NP_001157.1.92137 NP_001243092.1.87134 NP_001243092.1.92137 XP_003828433.1.60992 ENSP00000227758 HR3640 ENSP00000227758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]