SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000228027 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000228027
Domain Number - Region: 255-284,320-370
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.0131
Family Glycerol-3-phosphate (1)-acyltransferase 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000228027   Gene: ENSG00000062282   Transcript: ENST00000228027
Sequence length 388
Comment pep:known chromosome:GRCh37:11:75479777:75512579:1 gene:ENSG00000062282 transcript:ENST00000228027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLN
RSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKG
GRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATE
VSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGG
AAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQ
KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHT
MYMEALVKLFDKHKTKFGLPETEVLEVN
Download sequence
Identical sequences G3QK91 H2Q4F5 Q96PD7
GO.36796 9598.ENSPTRP00000007025 9606.ENSP00000228027 ENSP00000228027 ENSPTRP00000007025 ENSGGOP00000002861 gi|26024197|ref|NP_115953.2| ENSP00000228027 ENSPTRP00000007025 ENSP00000228027 ENSGGOP00000002861 NP_115953.2.87134 NP_115953.2.92137 XP_003814755.1.60992 XP_004051883.1.27298 XP_522113.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]