SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000242261 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000242261
Domain Number 1 Region: 108-182
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000242261   Gene: ENSG00000122691   Transcript: ENST00000242261
Sequence length 202
Comment pep:known chromosome:GRCh37:7:19155091:19157295:-1 gene:ENSG00000122691 transcript:ENST00000242261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGV
GGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQR
TQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAH
ERLSYAFSVWRMEGAWSMSASH
Download sequence
Identical sequences Q15672
ENSP00000242261 9606.ENSP00000242261 ENSP00000242261 ENSP00000416986 gi|4507741|ref|NP_000465.1| HR6409 NYSGXRC-13001a NP_000465.1.87134 NP_000465.1.92137 XP_011513798.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]