SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000242994 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000242994
Domain Number 1 Region: 86-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000242994   Gene: ENSG00000123307   Transcript: ENST00000242994
Sequence length 331
Comment pep:known chromosome:GRCh37:12:55413729:55423798:1 gene:ENSG00000123307 transcript:ENST00000242994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTFVKSKEMGELVNTPSWMDKGLGSQNEVKEEESRPGTYGMLSSLTEEHDSIEEEEEE
EEDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKT
QKLSKIETLRLARNYIWALSEVLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQS
VLLEKHEDKSPICDSAISVHNFNYQSPGLPSPPYGHMETHLLHLKPQVFKSLGESSFGSH
LPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYSFMPHYPSSSLSSGHVHSTPFQA
GTPRYDVPIDMSYDSYPHHGIGTQLNTVFTE
Download sequence
Identical sequences Q9HD90
NYSGRC-153792190 ENSP00000242994 NP_067014.2.87134 NP_067014.2.92137 gi|153792190|ref|NP_067014.2| 9606.ENSP00000242994 ENSP00000242994 ENSP00000242994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]