SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000254166 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000254166
Domain Number 1 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 551-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.65e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 608-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.63e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 327-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-21
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 7 Region: 34-91
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.76e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 8 Region: 653-705
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 281-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000186
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 112-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000745
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 11 Region: 228-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000752
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  ENSP00000254166
Domain Number - Region: 173-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00805
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000254166   Gene: ENSG00000131849   Transcript: ENST00000254166
Sequence length 706
Comment pep:known chromosome:GRCh37:19:58944181:58951589:-1 gene:ENSG00000131849 transcript:ENST00000254166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPSPQVLMGLPALLMGPAQHTSWPCGSAVPTLKSMVTFEDVAVYFSQEEWELLDAAQR
HLYHSVMLENLELVTSLGSWHGVEGEGAHPKQNVSVEVLQVRIPNADPSTKKANSCDMCG
PFLKDILHLAEHQGTQSEEKPYTCGACGRDFWLNANLHQHQKEHSGGKPFRWYKDRDALM
KSSKVHLSENPFTCREGGKVILGSCDLLQLQAVDSGQKPYSNLGQLPEVCTTQKLFECSN
CGKAFLKSSTLPNHLRTHSEEIPFTCPTGGNFLEEKSILGNKKFHTGEIPHVCKECGKAF
SHSSKLRKHQKFHTEVKYYECIACGKTFNHKLTFVHHQRIHSGERPYECDECGKAFSNRS
HLIRHEKVHTGERPFECLKCGRAFSQSSNFLRHQKVHTQVRPYECSQCGKSFSRSSALIQ
HWRVHTGERPYECSECGRAFNNNSNLAQHQKVHTGERPFECSECGRDFSQSSHLLRHQKV
HTGERPFECCDCGKAFSNSSTLIQHQKVHTGQRPYECSECRKSFSRSSSLIQHWRIHTGE
KPYECSECGKAFAHSSTLIEHWRVHTKERPYECNECGKFFSQNSILIKHQKVHTGEKPYK
CSECGKFFSRKSSLICHWRVHTGERPYECSECGRAFSSNSHLVRHQRVHTQERPYECIQC
GKAFSERSTLVRHQKVHTRERTYECSQCGKLFSHLCNLAQHKKIHT
Download sequence
Identical sequences P52740
ENSP00000254166 9606.ENSP00000254166 NP_003424.3.87134 NP_003424.3.92137 gi|154800449|ref|NP_003424.3| ENSP00000254166 ENSP00000254166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]